PDB entry 1v77

View 1v77 on RCSB PDB site
Description: Crystal structure of the PH1877 protein
Class: RNA binding protein
Keywords: RNase P protein, TIM-barrel, RNA BINDING PROTEIN
Deposited on 2003-12-12, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1877
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1877
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v77a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v77A (A:)
    mvggggvkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaills
    npkpslvrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklm
    vkknvalgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprd
    lislgvvigmeipqakasismypeiilkrlky
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v77A (A:)
    vkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaillsnpkpsl
    vrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklmvkknva
    lgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprdlislgv
    vigmeipqakasismypeiilk