PDB entry 1v76

View 1v76 on RCSB PDB site
Description: Crystal Structure of Archaeal Ribonuclease P Protein Ph1771p from Pyrococcus horikoshii OT3
Deposited on 2003-12-12, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v76a_
  • Chain 'B':
    Domains in SCOP 1.71: d1v76b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v76A (A:)
    gahrgrvtrrniiwheliglrvrivgsthpafvgiegyvidetrnmlviagdriwkvpkd
    vsifefeaddgtkikipgerlvgrpemrlkkrwkkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v76A (A:)
    grvtrrniiwheliglrvrivgsthpafvgiegyvidetrnmlviagdriwkvpkdvsif
    efeaddgtkikipgerlvgrpemrlkkrwkkw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v76B (B:)
    gahrgrvtrrniiwheliglrvrivgsthpafvgiegyvidetrnmlviagdriwkvpkd
    vsifefeaddgtkikipgerlvgrpemrlkkrwkkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v76B (B:)
    rvtrrniiwheliglrvrivgsthpafvgiegyvidetrnmlviagdriwkvpkdvsife
    feaddgtkikipgerlvgrpemrlkkrwkkw