PDB entry 1v75

View 1v75 on RCSB PDB site
Description: Crystal structure of hemoglobin D from the Aldabra giant tortoise (Geochelone gigantea) at 2.0 A resolution
Class: oxygen storage/transport
Keywords: hemoglobin d, reptilia, the aldabra giant tortoise, geochelone gigantea, oxygen storage/transport complex
Deposited on 2003-12-12, released 2003-12-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin D alpha chain
    Species: Dipsochelys dussumieri [TaxId:167804]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1v75a_
  • Chain 'B':
    Compound: Hemoglobin A and D beta chain
    Species: Dipsochelys dussumieri [TaxId:167804]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1v75b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v75A (A:)
    mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
    kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
    vqvaydkflaavsavlaekyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v75B (B:)
    vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv
    lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk
    eftpasqaawtklvnavahalalgyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v75B (B:)
    hwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakvl
    ahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpke
    ftpasqaawtklvnavahalal