PDB entry 1v75

View 1v75 on RCSB PDB site
Description: crystal structure of hemoglobin d from the aldabra giant tortoise (geochelone gigantea) at 2.0 a resolution
Deposited on 2003-12-12, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v75a_
  • Chain 'B':
    Domains in SCOP 1.67: d1v75b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v75A (A:)
    mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
    kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
    vqvaydkflaavsavlaekyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v75B (B:)
    vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv
    lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk
    eftpasqaawtklvnavahalalgyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v75B (B:)
    hwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakvl
    ahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpke
    ftpasqaawtklvnavahalal