PDB entry 1v74

View 1v74 on RCSB PDB site
Description: structure of the e. coli colicin d bound to its immunity protein immd
Deposited on 2003-12-10, released 2004-03-30
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1v74a_
  • Chain 'B':
    Domains in SCOP 1.69: d1v74b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v74A (A:)
    lndpldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyr
    rekgskvyfnpntmnvviiksngeflsgwkinpdadngriyletgel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v74B (B:)
    mnkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfep
    dadranyeiddnglkvevrsilekfkl