PDB entry 1v74

View 1v74 on RCSB PDB site
Description: ribonuclease-inhibitor complex
Class: antibiotic/immune system
Keywords: colicin D - ImmD complex, cytotoxicity, transfer RNase, protein-protein inhibition, ANTIBIOTIC/IMMUNE SYSTEM COMPLEX
Deposited on 2003-12-10, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colicin D
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v74a_
  • Chain 'B':
    Compound: Colicin D immunity protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v74b_
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v74A (A:)
    lndpldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyr
    rekgskvyfnpntmnvviiksngeflsgwkinpdadngriyletgel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v74B (B:)
    mnkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfep
    dadranyeiddnglkvevrsilekfkl