PDB entry 1v74

View 1v74 on RCSB PDB site
Description: Structure of the E. coli colicin D bound to its immunity protein ImmD
Class: antibiotic/immune system
Keywords: colicin D - ImmD complex, cytotoxicity, transfer RNase, protein-protein inhibition, ANTIBIOTIC-IMMUNE SYSTEM COMPLEX
Deposited on 2003-12-10, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-03, with a file datestamp of 2017-12-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Colicin D
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17998 (0-106)
  Domains in SCOPe 2.08: d1v74a_
• Chain 'B':
  Compound: Colicin D immunity protein
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11899 (0-86)
  Domains in SCOPe 2.08: d1v74b_
• Heterogens: 1PE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v74A (A:)
  lndpldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyr
  rekgskvyfnpntmnvviiksngeflsgwkinpdadngriyletgel
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v74B (B:)
  mnkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfep
  dadranyeiddnglkvevrsilekfkl