PDB entry 1v73

View 1v73 on RCSB PDB site
Description: Crystal Structure of Cold-Active Protein-Tyrosine Phosphatase of a Psychrophile Shewanella SP.
Deposited on 2003-12-09, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: psychrophilic phosphatase I
    Species: Shewanella sp. [TaxId:50422]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ACY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1v73A (A:)
    mgntatefdgpyvitpisgqstaywicdnrlkttsieklqvnrpehcgdlpetklsseik
    qimpdtylgikkvvalsdvhgqydvlltllkkqkiidsdgnwafgeghmvmtgdifdrgh
    qvnevlwfmyqldqqardaggmvhllmgnheqmvlggdlryvhqrydiattlinrpynkl
    ygadteigqwlrskntiikindvlymhggissewisreltldkanalyranvdaskkslk
    addllnflffgngptwyrgyfsetfteaeldtilqhfnvnhivvghtsqervlglfhnkv
    iavdssikvgksgellllennrlirglydgtretlqenslnq
    

    Sequence, based on observed residues (ATOM records):
    >1v73A (A:)
    tefdgpyvitpisgqstaywicdnrlkttsieklqvnrpehcgdlpetklsseikqimpd
    tylgikkvvalsdvhgqydvlltllkkqkiidsdgnwafgeghmvmtgdifdrghqvnev
    lwfmyqldqqardaggmvhllmgnheqmvlggdlryvhqrydiattlinrpynklygadt
    eigqwlrskntiikindvlymhggissewisreltldkanalyranvdaskkslkaddll
    nflffgngptwyrgyfsetfteaeldtilqhfnvnhivvghtsqervlglfhnkviavds
    sikvgksgellllennrlirglydgtretlq