PDB entry 1v71

View 1v71 on RCSB PDB site
Description: Crystal Structure of S.pombe Serine Racemase
Class: isomerase
Keywords: Dimer, PLP, ISOMERASE
Deposited on 2003-12-09, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein C320.14 in chromosome III
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v71a1
  • Heterogens: MG, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v71A (A:)
    msdnlvlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrg
    alnalsqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyg
    gqvimydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfv
    clggggllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtq
    hlgnytfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklkn
    krigiiisggnvdieryahflsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v71A (A:)
    vlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrgalnal
    sqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyggqvim
    ydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfvclggg
    gllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtqhlgny
    tfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklknkrigi
    iisggnvdieryahflsq