PDB entry 1v70

View 1v70 on RCSB PDB site
Description: Crystal Structure of probable antibiotics synthesis protein from Thermus thermophilus HB8
Deposited on 2003-12-05, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.203
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1v70a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v70A (A:)
  meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
  vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp