PDB entry 1v6z

View 1v6z on RCSB PDB site
Description: crystal structure of tt1573 from thermus thermophilus
Deposited on 2003-12-05, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v6zA (A:)
    mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvl
    eerrperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrr
    lravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalav
    gpeggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6zA (A:)
    rphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvle
    errperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrl
    ravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavg
    peggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v6zB (B:)
    mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvl
    eerrperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrr
    lravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalav
    gpeggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6zB (B:)
    hrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvleer
    rperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlra
    valeaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpe
    ggfaeeevalleargftpvslgrrilraetaalallalctagegr