PDB entry 1v6z

View 1v6z on RCSB PDB site
Description: Crystal structure of TT1573 from Thermus thermophilus
Class: transferase
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-12-05, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA0657
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72K73 (Start-227)
      • modified residue (112)
    Domains in SCOPe 2.07: d1v6za1, d1v6za2
  • Chain 'B':
    Compound: hypothetical protein TTHA0657
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72K73 (Start-227)
      • modified residue (112)
    Domains in SCOPe 2.07: d1v6zb1, d1v6zb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v6zA (A:)
    mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvl
    eerrperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrr
    lravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalav
    gpeggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6zA (A:)
    rphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvle
    errperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrl
    ravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavg
    peggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v6zB (B:)
    mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvl
    eerrperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrr
    lravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalav
    gpeggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6zB (B:)
    hrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvleer
    rperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlra
    valeaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpe
    ggfaeeevalleargftpvslgrrilraetaalallalctagegr