PDB entry 1v6y

View 1v6y on RCSB PDB site
Description: Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex
Class: hydrolase
Keywords: xylanase, TIM-barrel, chimeric enzyme, hydrolase
Deposited on 2003-12-04, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.153
AEROSPACI score: -1.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-D-xylanase and Endo-1,4-beta-xylanase B
    Species: Streptomyces olivaceoviridis, Cellulomonas fimi [TaxId:1921,1708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SI98 (207-314)
      • cloning artifact (315-317)
    Domains in SCOPe 2.07: d1v6ya1, d1v6ya2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v6yA (A:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirm
    rtpsdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdas
    yakkpayaavmeafgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6yA (A:)
    stlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfnfs
    agdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgkiaq
    wdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwakt
    qgvynmvrdfkqrgvpidcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeafgsrs