PDB entry 1v6x

View 1v6x on RCSB PDB site
Description: Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 3(3)-4-O-methyl-alpha-D-glucuronosyl-xylotriose
Class: hydrolase
Keywords: ALPHA-BETA BARREL, PROTEIN-SUGAR COMPLEX, CARBOHYDRATE BINDING MODULE, hydrolase
Deposited on 2003-12-04, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6xa1, d1v6xa2
  • Chain 'B':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6xb1, d1v6xb2
  • Heterogens: XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6xA (A:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6xB (B:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt