PDB entry 1v6v

View 1v6v on RCSB PDB site
Description: Crystal Structure Of Xylanase From Streptomyces Olivaceoviridis E-86 Complexed With 3(2)-alpha-L-arabinofuranosyl-xylotriose
Class: hydrolase
Keywords: ALPHA-BETA BARREL, PROTEIN-SUGAR COMPLEX, CARBOHYDRATE BINDING MODULE, hydrolase
Deposited on 2003-12-04, released 2004-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v6va1, d1v6va2
  • Chain 'B':
    Compound: endo-1,4-beta-D-xylanase
    Species: Streptomyces olivaceoviridis [TaxId:1921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v6vb1, d1v6vb2
  • Heterogens: XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6vA (A:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6vB (B:)
    aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
    fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
    aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
    ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
    nggsstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrv
    ygdkcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtli
    qlyscsngsnqrwtrt