PDB entry 1v6t

View 1v6t on RCSB PDB site
Description: Crystal Structure of Lactam Utilization Protein from Pyrococcus horikoshii Ot3
Class: structural genomics, unknown function
Keywords: TIM-BARREL, Lactam Utilization Protein, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-12-04, released 2004-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0271 protein PH0986
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v6ta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v6tA (A:)
    mrvdlnsdlgesfgryklgldeevmkyitsanvacgwhagdplvmrktvrlakendvqvg
    ahpgypdlmgfgrrymkltpeearnyilyqvgalyafakaeglelqhvkphgalynamvk
    eedlaraviegildfdkdlilvtlsnsrvadiaeemglkvahevfadraynpdgtlvprg
    rpgaviedkeeiaervismvkdggiraingewvdlkvdticvhgdnpkaveitsyirkvl
    eeegvkivpmkefir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6tA (A:)
    mrvdlnsdlgesfgryklgldeevmkyitsanvacgwhagdplvmrktvrlakendvqvg
    ahpgypdlmgfgrrymkltpeearnyilyqvgalyafakaeglelqhvkphgalynamvk
    eedlaraviegildfdkdlilvtlsnsrvadiaeemglkvahevfadraynpdgtlvpav
    iedkeeiaervismvkdggiraingewvdlkvdticvhgdnpkaveitsyirkvleeegv
    kivpmkefi