PDB entry 1v6p

View 1v6p on RCSB PDB site
Description: Crystal structure of Cobrotoxin
Class: toxin
Keywords: atomic resolution, short-chain neurotoxin, Naja atra, Copper ion
Deposited on 2003-12-03, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.87 Å
R-factor: 0.119
AEROSPACI score: 1.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cobrotoxin
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6pa_
  • Chain 'B':
    Compound: cobrotoxin
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6pb_
  • Heterogens: CU, CL, NA, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6pA (A:)
    lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
    nn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6pB (B:)
    lechnqqssqtptttgcsggetncykkrwrdhrgyrtergcgcpsvkngieinccttdrc
    nn