PDB entry 1v6n

View 1v6n on RCSB PDB site
Description: peanut lectin with 9mer peptide (pviwssatg)
Deposited on 2003-12-02, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.187
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v6na_
  • Chain 'B':
    Domains in SCOP 1.67: d1v6nb_
  • Chain 'C':
    Domains in SCOP 1.67: d1v6nc_
  • Chain 'D':
    Domains in SCOP 1.67: d1v6nd_
  • Chain 'E':
    Domains in SCOP 1.67: d1v6ne_
  • Chain 'F':
    Domains in SCOP 1.67: d1v6nf_
  • Chain 'G':
    Domains in SCOP 1.67: d1v6ng_
  • Chain 'H':
    Domains in SCOP 1.67: d1v6nh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nA (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nB (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nC (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nD (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nE (E:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nF (F:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nG (G:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6nH (H:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt