PDB entry 1v6k

View 1v6k on RCSB PDB site
Description: Peanut lectin-lactose complex in the presence of peptide(IWSSAGNVA)
Class: sugar binding protein
Keywords: Lectin, open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography, agglutinin, peptide
Deposited on 2003-12-01, released 2004-02-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.177
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v6ka_
  • Chain 'B':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v6kb_
  • Chain 'C':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v6kc_
  • Chain 'D':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v6kd_
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6kA (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6kB (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6kC (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6kD (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt