PDB entry 1v6h

View 1v6h on RCSB PDB site
Description: The Trimeric Structure Of Divalent Cation Tolerance Protein CutA1 From Thermus Thermophilus HB8
Deposited on 2003-11-29, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v6ha_
  • Chain 'B':
    Domains in SCOP 1.67: d1v6hb_
  • Chain 'C':
    Domains in SCOP 1.67: d1v6hc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6hA (A:)
    meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
    thafpklkervkalhpytvpeivalpiaegnreyldwlrentg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6hB (B:)
    meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
    thafpklkervkalhpytvpeivalpiaegnreyldwlrentg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6hC (C:)
    meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
    thafpklkervkalhpytvpeivalpiaegnreyldwlrentg