PDB entry 1v6h

View 1v6h on RCSB PDB site
Description: The Trimeric Structure Of Divalent Cation Tolerance Protein CutA1 From Thermus Thermophilus HB8
Class: structural genomics, unknown function
Keywords: CutA, Copper Tolerance, Trimer, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-11-29, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Divalent Cation Tolerance Protein CutA1
  Species: Thermus thermophilus [TaxId:274]
  Gene: CUTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SIA8 (0-102)
  Domains in SCOPe 2.08: d1v6ha_
• Chain 'B':
  Compound: Divalent Cation Tolerance Protein CutA1
  Species: Thermus thermophilus [TaxId:274]
  Gene: CUTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SIA8 (0-102)
  Domains in SCOPe 2.08: d1v6hb_
• Chain 'C':
  Compound: Divalent Cation Tolerance Protein CutA1
  Species: Thermus thermophilus [TaxId:274]
  Gene: CUTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SIA8 (0-102)
  Domains in SCOPe 2.08: d1v6hc_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v6hA (A:)
  meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
  thafpklkervkalhpytvpeivalpiaegnreyldwlrentg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v6hB (B:)
  meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
  thafpklkervkalhpytvpeivalpiaegnreyldwlrentg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v6hC (C:)
  meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
  thafpklkervkalhpytvpeivalpiaegnreyldwlrentg