PDB entry 1v6g

View 1v6g on RCSB PDB site
Description: Solution Structure of the LIM Domain of the Human Actin Binding LIM Protein 2
Class: metal binding protein
Keywords: LIM Domain, Zinc Binding Domain, Actin Binding LIM Protein 2, ABLIM2, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2003-11-29, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Actin Binding LIM Protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA fk00917
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6H8Q1 (7-74)
    • cloning artifact (0-6)
    • cloning artifact (75-80)
  Domains in SCOPe 2.07: d1v6ga1, d1v6ga2, d1v6ga3, d1v6ga4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v6gA (A:)
  gssgssgldyqrlygtrcfscdqfiegevvsalgktyhpdcfvcavcrlpfppgdrvtfn
  gkecmcqkcslpvsvsgpssg