PDB entry 1v6g

View 1v6g on RCSB PDB site
Description: solution structure of the lim domain of the human actin binding lim protein 2
Deposited on 2003-11-29, released 2004-06-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v6gA (A:)
gssgssgldyqrlygtrcfscdqfiegevvsalgktyhpdcfvcavcrlpfppgdrvtfn
gkecmcqkcslpvsvsgpssg