PDB entry 1v6f

View 1v6f on RCSB PDB site
Description: Solution Structure of Glia Maturation Factor-beta from Mus Musculus
Class: hormone/growth factor
Keywords: ACTIN BINDING PROTEIN, CYTOSKELETON, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-11-29, released 2004-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glia maturation factor, beta
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 3110001H22
    Database cross-references and differences (RAF-indexed):
    • GB BAB29076 (7-144)
      • cloning artifact (0-6)
      • cloning artifact (145-150)
    Domains in SCOPe 2.07: d1v6fa1, d1v6fa2, d1v6fa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6fA (A:)
    gssgssgseslvvcdvaedlveklrkfrfrkethnaaiimkidkderlvvldeelegvsp
    delkdelperqprfivysykyqhddgrvsyplcfifsspvgckpeqqmmyagsknklvqt
    aeltkvfeirntedlteewlreklgsgpssg