PDB entry 1v6e

View 1v6e on RCSB PDB site
Description: Solution Structure of a N-terminal Ubiquitin-like Domain in Mouse Tubulin-specific Chaperone B
Class: structural protein
Keywords: Tubulin-specific Chaperone B, Tubulin folding cofactor B, Cytoskeleton-associated protein CKAP1, Cytoskeleton, Microtubule, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2003-11-29, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoskeleton-associated protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2410007D12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D1E6 (7-88)
      • cloning artifact (0-6)
      • engineered (80)
      • cloning artifact (89-94)
    Domains in SCOPe 2.08: d1v6ea1, d1v6ea2, d1v6ea3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6eA (A:)
    gssgssgvmvfissslnsfrsekrysrsltiaefkcklelvvgspascmelelygaddkf
    yskldqedallgsypvddgcrihvidhsgsgpssg