PDB entry 1v6c

View 1v6c on RCSB PDB site
Description: Crystal Structure of Psychrophilic Subtilisin-like Protease Apa1 from Antarctic Psychrotroph Pseudoalteromonas sp. AS-11
Class: hydrolase
Keywords: parallel-antiparallel-barrel, insert domain, HYDROLASE
Deposited on 2003-11-28, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline serine protease
    Species: Pseudoalteromonas sp. [TaxId:247492]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6ca_
  • Chain 'B':
    Compound: Alkaline serine protease
    Species: Pseudoalteromonas sp. [TaxId:247492]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v6cb_
  • Heterogens: CA, SO4, PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v6cA (A:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgptdpgtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6cA (A:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v6cB (B:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgptdpgtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v6cB (B:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgpt