PDB entry 1v6b

View 1v6b on RCSB PDB site
Description: Solution structure of the third PDZ domain of mouse harmonin
Class: protein binding
Keywords: structural genomics, Usher syndrome, USH1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-11-28, released 2004-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: harmonin isoform a1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2010016F01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ES64 (7-117)
      • cloning artifact (0-6)
    Domains in SCOPe 2.07: d1v6ba1, d1v6ba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v6bA (A:)
    gsegaatmfspeqiagkdvrllrikkegsldlaleggvdspvgkvvvsavyeggaaerhg
    gvvkgdeimaingkivtdytlaeaeaalqkawnqggdwidlvvavcppkeyddeltff