PDB entry 1v67

View 1v67 on RCSB PDB site
Description: structure of ferripyochelin binding protein from pyrococcus horikoshii ot3
Deposited on 2003-11-27, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v67a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v67A (A:)
maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri