PDB entry 1v67

View 1v67 on RCSB PDB site
Description: Structure of ferripyochelin binding protein from pyrococcus horikoshii OT3
Class: transferase
Keywords: BETA-HELIX, CARBONIC ANHYDRASE, Bicarbonate, calcium binding, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-11-27, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferripyochelin binding protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v67a_
  • Heterogens: BCT, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v67A (A:)
    maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
    nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
    vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri