PDB entry 1v66

View 1v66 on RCSB PDB site
Description: Solution structure of human p53 binding domain of PIAS-1
Class: ligase
Keywords: four helix bundle, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2003-11-27, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein inhibitor of activated STAT protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v66a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v66A (A:)
    madsaelkqmvmslrvselqvllgyagrnkhgrkhelltkalhllkagcspavqmkikel
    yrrrf