PDB entry 1v65

View 1v65 on RCSB PDB site
Description: Solution structure of the Kruppel-associated box (KRAB) domain
Class: gene regulation
Keywords: transcriptional repressor, heterochromatin, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2003-11-27, released 2004-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIKEN cDNA 2610044O15
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2610044O15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BG62 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.05: d1v65a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v65A (A:)
    gssgssgvtyddvhmnfteeewdlldssqkrlyeevmletyqnltdigynwqdhhieesg
    pssg