PDB entry 1v63

View 1v63 on RCSB PDB site
Description: solution structure of the 6th hmg box of mouse ubf1
Deposited on 2003-11-27, released 2004-05-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-27, with a file datestamp of 2004-05-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1v63a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v63A (A:)
  gssgssgpkkppmngyqkfsqellsngelnhlplkermveigsrwqrisqsqkehykkla
  eeqqrqykvhldlwvkslspqdraaykeyisnkrksgpssg