PDB entry 1v63

View 1v63 on RCSB PDB site
Description: Solution structure of the 6th HMG box of mouse UBF1
Class: DNA binding protein
Keywords: Transcription factor, DNA binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2003-11-27, released 2004-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolar transcription factor 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1300010N03
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25976 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.07: d1v63a1, d1v63a2, d1v63a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v63A (A:)
    gssgssgpkkppmngyqkfsqellsngelnhlplkermveigsrwqrisqsqkehykkla
    eeqqrqykvhldlwvkslspqdraaykeyisnkrksgpssg