PDB entry 1v63

View 1v63 on RCSB PDB site
Description: Solution structure of the 6th HMG box of mouse UBF1
Class: DNA binding protein
Keywords: Transcription factor, DNA binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2003-11-27, released 2004-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nucleolar transcription factor 1
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1300010N03
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25976 (7-94)
    • cloning artifact (0-6)
    • cloning artifact (95-100)
  Domains in SCOPe 2.08: d1v63a1, d1v63a2, d1v63a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v63A (A:)
  gssgssgpkkppmngyqkfsqellsngelnhlplkermveigsrwqrisqsqkehykkla
  eeqqrqykvhldlwvkslspqdraaykeyisnkrksgpssg