PDB entry 1v61

View 1v61 on RCSB PDB site
Description: solution structure of the pleckstrin homology domain of alpha-pix
Deposited on 2003-11-26, released 2004-05-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-26, with a file datestamp of 2004-05-26.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v61a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v61A (A:)
gssgssgqilsepiqawegddiktlgnvifmsqvvmqhgaceekeeryfllfssvlimls
asprmsgfmyqgkipiagmvvnrldeiegsdcmfeitgstverivvhcnnnqdfqewmeq
lnrltksgpssg