PDB entry 1v61

View 1v61 on RCSB PDB site
Description: Solution Structure of the Pleckstrin Homology Domain of alpha-Pix
Class: signaling protein
Keywords: Pleckstrin homology domain, Guanine nucleotide exchange factor, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-11-26, released 2004-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1700038J06
    Database cross-references and differences (RAF-indexed):
    • GB AAM94903 (7-125)
      • cloning artifact (0-6)
      • cloning artifact (126-131)
    Domains in SCOPe 2.07: d1v61a1, d1v61a2, d1v61a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v61A (A:)
    gssgssgqilsepiqawegddiktlgnvifmsqvvmqhgaceekeeryfllfssvlimls
    asprmsgfmyqgkipiagmvvnrldeiegsdcmfeitgstverivvhcnnnqdfqewmeq
    lnrltksgpssg