PDB entry 1v60

View 1v60 on RCSB PDB site
Description: Solution structure of BolA1 protein from Mus musculus
Deposited on 2003-11-26, released 2005-01-18
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIKEN cDNA 1810037G04
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D8S9 (7-122)
      • cloning artifact (0-6)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1v60A (A:)
    gssgssgmatrscvsrgsagsaaagpveaairakleqalspevlelrnesgghavpagse
    thfrvavvssrfegmsplqrhrlvhealseelagpvhalaiqaktpaqwrenpqldispp
    clg