PDB entry 1v5z

View 1v5z on RCSB PDB site
Description: Binding of coumarins to NAD(P)H:FMN oxidoreductase
Class: oxidoreductase
Keywords: FMN oxidoreductase, inhibitor, o-coumaric acid, 4-hydroxycoumarin
Deposited on 2003-11-26, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major NAD(P)H-flavin oxidoreductase
    Species: Aliivibrio fischeri [TaxId:668]
    Gene: FRaseI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5za_
  • Chain 'B':
    Compound: Major NAD(P)H-flavin oxidoreductase
    Species: Aliivibrio fischeri [TaxId:668]
    Gene: FRaseI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5zb_
  • Heterogens: FMN, 2HC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5zA (A:)
    thpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakqr
    mhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafas
    fkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadelk
    gyechvalaigyhhpsedynaslpksrkafedvitil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5zB (B:)
    thpiihdlenrytskkydpskkvsqedlavllealrlsassinsqpwkfiviesdaakqr
    mhdsfanmhqfnqphikacshvilfanklsytrddydvvlskavadkriteeqkeaafas
    fkfvelncdengehkawtkpqaylalgnalhtlarlnidsttmegidpellseifadelk
    gyechvalaigyhhpsedynaslpksrkafedvitil