PDB entry 1v5x

View 1v5x on RCSB PDB site
Description: Crystal structure of Phosphoribosyl anthranilate isomerase from Thermus Thermophilus
Deposited on 2003-11-26, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.262
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v5xa_
  • Chain 'B':
    Domains in SCOP 1.67: d1v5xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v5xA (A:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslrmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5xA (A:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v5xB (B:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslrmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5xB (B:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslr