PDB entry 1v5x

View 1v5x on RCSB PDB site
Description: Crystal structure of Phosphoribosyl anthranilate isomerase from Thermus Thermophilus
Class: isomerase
Keywords: isomerase, alpha-beta barrel, TrpF, phosphoribosyl anthranilate isomerase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-11-26, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.262
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylanthranilate isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5xa_
  • Chain 'B':
    Compound: Phosphoribosylanthranilate isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v5xA (A:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslrmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5xA (A:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v5xB (B:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslrmeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5xB (B:)
    mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
    dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
    llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
    pgvksaeklralfarlaslr