PDB entry 1v5w

View 1v5w on RCSB PDB site
Description: Crystal structure of the human Dmc1 protein
Class: recombination
Keywords: DNA-binding protein, ring protein, octamer, AAA ATPase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RECOMBINATION
Deposited on 2003-11-26, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.294
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Meiotic recombination protein DMC1/LIM15 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: DMC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5wa_
  • Chain 'B':
    Compound: Meiotic recombination protein DMC1/LIM15 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: DMC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v5wA (A:)
    gshmkedqvvaeepgfqdeeeslfqdidllqkhginvadikklksvgictikgiqmttrr
    alcnvkglseakvdkikeaankliepgfltafeysekrkmvfhittgsqefdkllgggie
    smaiteafgefrtgktqlshtlcvtaqlpgaggypggkiifidtentfrpdrlrdiadrf
    nvdhdavldnvlyaraytsehqmelldyvaakfheeagifklliidsimalfrvdfsgrg
    elaerqqklaqmlsrlqkiseeynvavfvtnqmtadpgatmtfqadpkkpigghilahas
    ttrislrkgrgelriakiydspempeneatfaitaggigdake
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5wA (A:)
    pgfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvt
    aqlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmel
    ldyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynv
    avfvtnqmghilahasttrislrkgrgelriakiydspempeneatfaitaggigdake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v5wB (B:)
    gshmkedqvvaeepgfqdeeeslfqdidllqkhginvadikklksvgictikgiqmttrr
    alcnvkglseakvdkikeaankliepgfltafeysekrkmvfhittgsqefdkllgggie
    smaiteafgefrtgktqlshtlcvtaqlpgaggypggkiifidtentfrpdrlrdiadrf
    nvdhdavldnvlyaraytsehqmelldyvaakfheeagifklliidsimalfrvdfsgrg
    elaerqqklaqmlsrlqkiseeynvavfvtnqmtadpgatmtfqadpkkpigghilahas
    ttrislrkgrgelriakiydspempeneatfaitaggigdake
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5wB (B:)
    pgfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvt
    aqlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmel
    ldyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynv
    avfvtnqmghilahasttrislrkgrgelriakiydspempeneatfaitaggigdake