PDB entry 1v5v

View 1v5v on RCSB PDB site
Description: Crystal Structure of a Component of Glycine Cleavage System: T-protein from Pyrococcus horikoshii OT3 at 1.5 A Resolution
Class: transferase
Keywords: GLYCINE-CLEAVAGE SYTEM, AMINOMETHYL TRANSFERASE, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-11-26, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminomethyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: GCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5va1, d1v5va2
  • Chain 'B':
    Compound: Aminomethyltransferase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: GCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v5vb1, d1v5vb2
  • Heterogens: GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v5vA (A:)
    miqmvkrvhifdwhkeharkieefagwempiwyssikeehlavrnavgifdvshmgeivf
    rgkdalkflqyvttndiskppaisgtytlvlnergaikdetlvfnmgnneylmicdsdaf
    eklyawftylkrtieqftkldleielktydiamfavqgpkardlakdlfgidinemwwfq
    arwveldgikmllsrsgytgengfevyiedanpyhpdeskrgepekalhvwerileegkk
    ygikpcglgardtlrleagytlygnetkelqllstdidevtplqanlefaiywdkdfigk
    dallkqkergvgrklvhfkmidkgipregykvyangemigevtsgtlspllnvgigiafv
    keeyakpgieieveirgqrkkavtvtppfydpkkyglfret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5vA (A:)
    qmvkrvhifdwhkeharkieefagwempiwyssikeehlavrnavgifdvshmgeivfrg
    kdalkflqyvttndiskppaisgtytlvlnergaikdetlvfnmgnneylmicdsdafek
    lyawftylkrtieqftkldleielktydiamfavqgpkardlakdlfgidinemwwfqar
    wveldgikmllsrsgytgengfevyiedanpyhpdeskrgepekalhvwerileegkkyg
    ikpcglgardtlrleagytlygnetkelqllstdidevtplqanlefaiywdkdfigkda
    llkqkergvgrklvhfkmidkgipregykvyangemigevtsgtlspllnvgigiafvke
    eyakpgieieveirgqrkkavtvtppfydpkkyglfret
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v5vB (B:)
    miqmvkrvhifdwhkeharkieefagwempiwyssikeehlavrnavgifdvshmgeivf
    rgkdalkflqyvttndiskppaisgtytlvlnergaikdetlvfnmgnneylmicdsdaf
    eklyawftylkrtieqftkldleielktydiamfavqgpkardlakdlfgidinemwwfq
    arwveldgikmllsrsgytgengfevyiedanpyhpdeskrgepekalhvwerileegkk
    ygikpcglgardtlrleagytlygnetkelqllstdidevtplqanlefaiywdkdfigk
    dallkqkergvgrklvhfkmidkgipregykvyangemigevtsgtlspllnvgigiafv
    keeyakpgieieveirgqrkkavtvtppfydpkkyglfret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v5vB (B:)
    qmvkrvhifdwhkeharkieefagwempiwyssikeehlavrnavgifdvshmgeivfrg
    kdalkflqyvttndiskppaisgtytlvlnergaikdetlvfnmgnneylmicdsdafek
    lyawftylkrtieqftkldleielktydiamfavqgpkardlakdlfgidinemwwfqar
    wveldgikmllsrsgytgengfevyiedanpyhpdeskrgepekalhvwerileegkkyg
    ikpcglgardtlrleagytlygnetkelqllstdidevtplqanlefaiywdkdfigkda
    llkqkergvgrklvhfkmidkgipregykvyangemigevtsgtlspllnvgigiafvke
    eyakpgieieveirgqrkkavtvtppfydpkkyglfret