PDB entry 1v5u

View 1v5u on RCSB PDB site
Description: Solution Structure of the C-terminal Pleckstrin Homology Domain of Sbf1 from Mouse
Class: signaling protein
Keywords: Sbf1, MTMR5, the Pleckstrin Homology domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SET binding factor 1
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2610510A08
  Database cross-references and differences (RAF-indexed):
  • GB BAC36139 (7-110)
    • cloning artifact (0-6)
    • cloning artifact (111-116)
  Domains in SCOPe 2.08: d1v5ua1, d1v5ua2, d1v5ua3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v5uA (A:)
  gssgssgrsyegilykkgafmkpwkarwfvldktkhqlryydhrmdteckgvidlaevea
  vapgtptigapktvdekaffdvkttrrvynfcaqdvpsaqqwvdriqsclssgpssg