PDB entry 1v5t

View 1v5t on RCSB PDB site
Description: Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 8430435I17Rik Protein
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 8430435I17Rik Protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 8430435I17
  Database cross-references and differences (RAF-indexed):
  • GB BAC31711 (7-83)
    • cloning artifact (0-6)
    • cloning artifact (84-89)
  Domains in SCOPe 2.08: d1v5ta1, d1v5ta2, d1v5ta3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v5tA (A:)
  gssgssglpiivkwggqeysvttlseddtvldlkqflktltgvlperqkllglkvkgkpa
  endvklgalklkpntkimmmgtresgpssg