PDB entry 1v5s

View 1v5s on RCSB PDB site
Description: Solution structure of kinase associated domain 1 of mouse MAP/microtubule affinity-regulating kinase 3
Class: transferase
Keywords: KA1 domain, ELKL motif, MARK3, phosphorylation, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP/microtubule affinity-regulating kinase 3
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1600015G02
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03141 (40-119)
      • see remark 999 (0-39)
      • conflict (50)
      • cloning artifact (120-125)
    Domains in SCOPe 2.08: d1v5sa1, d1v5sa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v5sA (A:)
mkdhlihnvhkeehahahnkdydipttenlyfqgssgssgdmmreirkvlganncdyeqr
erfllfcvhgdghaenlvqwemevcklprlslngvrfkrisgtsiafkniaskianelkl
sgpssg