PDB entry 1v5r

View 1v5r on RCSB PDB site
Description: Solution Structure of the Gas2 Domain of the Growth Arrest Specific 2 Protein
Class: apoptosis
Keywords: Gas2 Domain, Zinc Binding Domain, Growth Arrest, Apoptosis, Cell Cycle, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-11-25, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth-arrest-specific protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 4631403A13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11862 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.07: d1v5ra1, d1v5ra2, d1v5ra3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5rA (A:)
    gssgssgnllddavkrisedppckcptkfcverlsqgryrvgekilfirmlhnkhvmvrv
    gggwetfagyllkhdpcrmlqisrvdgktspsgpssg