PDB entry 1v5q

View 1v5q on RCSB PDB site
Description: solution structure of the pdz domain from mouse glutamate receptor interacting protein 1a-l (grip1) homolog
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1v5qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5qA (A:)
    gssgssgagqvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaer
    cgvlqigdrvmaingiptedstfeeanqllrdssitskvtleiefdvaesvipssgsgps
    sg