PDB entry 1v5q

View 1v5q on RCSB PDB site
Description: Solution Structure of the PDZ Domain from Mouse Glutamate Receptor Interacting Protein 1A-L (GRIP1) Homolog
Class: protein binding
Keywords: PDZ domain, cellular signaling, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate Receptor Interacting Protein 1A-L Homolog
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 4931400F03
    Database cross-references and differences (RAF-indexed):
    • GB BAC26668 (7-115)
      • cloning artifact (0-6)
      • cloning artifact (116-121)
    Domains in SCOPe 2.07: d1v5qa1, d1v5qa2, d1v5qa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5qA (A:)
    gssgssgagqvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaer
    cgvlqigdrvmaingiptedstfeeanqllrdssitskvtleiefdvaesvipssgsgps
    sg