PDB entry 1v5p

View 1v5p on RCSB PDB site
Description: Solution Structure of the N-terminal Pleckstrin Homology Domain Of TAPP2 from Mouse
Class: signaling protein
Keywords: TAPP2, the Pleckstrin Homology domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, signaling protein
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pleckstrin homology domain-containing, family A
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 6430512N22
    Database cross-references and differences (RAF-indexed):
    • GB NP_112547 (7-119)
      • cloning artifact (0-6)
      • cloning artifact (120-125)
    Domains in SCOPe 2.08: d1v5pa1, d1v5pa2, d1v5pa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5pA (A:)
    gssgssgmpyvdrqnricgfldiednensgkflrryfildtqancllwymdnpqnlavga
    gavgslqltyiskvsiatpkqkpktpfcfvinalsqryflqandqkdlkdwvealnqask
    sgpssg