PDB entry 1v5n

View 1v5n on RCSB PDB site
Description: Solution Structure of DC1 Domain of PDI-like Hypothetical Protein from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: DC1 Domain, Zinc Binding Domain, PDI-like Protein, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PDI-like Hypothetical Protein At1g60420
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: RIKEN cDNA RAFL09-40-E23
  Database cross-references and differences (RAF-indexed):
  • GB AAL38874 (7-82)
    • cloning artifact (0-6)
    • cloning artifact (83-88)
  Domains in SCOPe 2.07: d1v5na1, d1v5na2, d1v5na3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v5nA (A:)
  gssgssgteerlkeieakydeiakdwpkkvkhvlheeheleltrvqvytcdkceeegtiw
  syhcdecdfdlhakcalnedtkesgpssg