PDB entry 1v5m

View 1v5m on RCSB PDB site
Description: Solution Structure of the Pleckstrin Homology Domain of Mouse APS
Class: protein binding
Keywords: adaptor protein, Pleckstrin Homology domain, cellular signaling, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH2 and PH domain-containing adapter protein APS
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5730427K19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JID9 (7-129)
      • cloning artifact (0-6)
      • engineered (7)
      • cloning artifact (130-135)
    Domains in SCOPe 2.07: d1v5ma1, d1v5ma2, d1v5ma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5mA (A:)
    gssgssgnlaakvelvdiqregalrfmvaddaasgpggtaqwqkcrlllrravagerfrl
    effvppkasrpkvsiplsaiievrttmplempekdntfvlkvengaeyiletidslqkhs
    wvadiqgcvdsgpssg