PDB entry 1v5l

View 1v5l on RCSB PDB site
Description: Solution structure of PDZ domain of mouse Alpha-actinin-2 associated LIM protein
Class: structural protein
Keywords: PDZ domain, cytoskeleton, actin binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PDZ and LIM domain 3; actinin alpha 2 associated LIM protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 6720456D19
    Database cross-references and differences (RAF-indexed):
    • GB NP_058078 (7-96)
      • cloning artifact (0-6)
      • cloning artifact (97-102)
    Domains in SCOPe 2.08: d1v5la1, d1v5la2, d1v5la3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v5lA (A:)
gssgssgnvvlpgpapwgfrlsggidfnqplvitritpgskaaaanlcpgdvilaidgfg
tesmthadaqdrikaasyqlclkidraetrlwspqvssgpssg